![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01002743G0050 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 124aa MW: 14198.3 Da PI: 10.2305 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.8 | 2.5e-32 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss PH01002743G0050 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.184 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.5E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.14E-42 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 3.79E-33 | 2 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSQ 60 ASNMEGILDR YQRYSFEERA VLDPNIGDQA NWGDEYGRLK TKLEAIQKSQ RCFGLFQLKA 120 IVR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_S | 1e-21 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-21 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-21 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_P | 1e-21 | 1 | 75 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU352648 | 1e-175 | EU352648.1 Phyllostachys praecox flower development related protein (MADS1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010235820.1 | 2e-71 | PREDICTED: MADS-box transcription factor 18 isoform X1 | ||||
Swissprot | A2YNI2 | 2e-67 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 2e-67 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | X2F437 | 2e-77 | X2F437_9POAL; MADS-box protein 18 | ||||
STRING | Si030896m | 3e-70 | (Setaria italica) | ||||
STRING | BRADI1G21980.2 | 7e-70 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 2e-49 | MIKC_MADS family protein |