PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002743G0050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 124aa    MW: 14198.3 Da    PI: 10.2305
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002743G0050genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF101.82.5e-321059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss
  PH01002743G0050 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59
                     8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-39160IPR002100Transcription factor, MADS-box
CDDcd002654.14E-42275No hitNo description
SuperFamilySSF554553.79E-33284IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-32323IPR002100Transcription factor, MADS-box
PfamPF003198.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSQ  60
ASNMEGILDR YQRYSFEERA VLDPNIGDQA NWGDEYGRLK TKLEAIQKSQ RCFGLFQLKA  120
IVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-21175173Myocyte-specific enhancer factor 2B
1tqe_R1e-21175173Myocyte-specific enhancer factor 2B
1tqe_Q1e-21175173Myocyte-specific enhancer factor 2B
1tqe_P1e-21175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3526481e-175EU352648.1 Phyllostachys praecox flower development related protein (MADS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235820.12e-71PREDICTED: MADS-box transcription factor 18 isoform X1
SwissprotA2YNI22e-67MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T42e-67MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLX2F4372e-77X2F437_9POAL; MADS-box protein 18
STRINGSi030896m3e-70(Setaria italica)
STRINGBRADI1G21980.27e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-49MIKC_MADS family protein